PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g020620.1
Common NameMTR_2g020620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 746aa    MW: 83697.9 Da    PI: 6.7874
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g020620.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP98.17.9e-31991651177
                      -TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP  11 lseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +se+k yhrrh+vC  +++a++v+++g  +r+CqqC++fh ls+fDe+krsCrr+L++hn rrr+k+
  Medtr2g020620.1  99 FSELKGYHRRHRVCLRCANAATVVLDGDVKRYCQQCGKFHVLSDFDEGKRSCRRKLERHNTRRRRKA 165
                      6899************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114124.37687164IPR004333Transcription factor, SBP-box
PfamPF031102.7E-2299164IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.105.4E-2199151IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.18E-2799168IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 746 aa     Download sequence    Send to blast
MESKSQPILP PMDPPEDLSS VWDLSYLLDF DDDIPQLPPL PNPNPTPEEN ERIRKRDPRL  60
TCSNFLAGQV PCACPELDAL LEDNGLPGKK RARTARLIFS ELKGYHRRHR VCLRCANAAT  120
VVLDGDVKRY CQQCGKFHVL SDFDEGKRSC RRKLERHNTR RRRKAVDSAV GVDNEVQTVT  180
QNDDSNCDGE LGIDYSNLSR ENIEKRALQD HEEEPVVNGS STPETQNING DSVVSFVASA  240
ETQANIGKDV SDPSKSPSYC DNKSDYSSMC QTGRVSFKLY DWNPAEFPRR LRLQIFQWLA  300
SMPVELEGYI RPGCTILTIF IAMPNIMWIN LLKDPMYYVR DLAAPRNMLS GRGTALIHLN  360
DMIFRVMKDG ISVTKVEVNM QAPRLHYIHP TCFEAGKPME FFACGSNLLQ PKFRLLVSFY  420
GKYLKCEYCA PSPHNSAEDN ISCAFDNQLY KICVPHIEEN LLGPAFIEVE NESGLSNFIP  480
VLIGDKEICT ELKILQQKLD ASLLSKQFRS ASGSSICSSC EAFVHIHTSS SDLLVDIAWL  540
LKDPTSENFD RMVSASQIQR YCYLLDFLIC NDSTIILGKI LPNLISITKS MKSNISDVDM  600
DQLLKGMCNA RDAICRKGGG IVLNSKMEGF KPAQCSSQNA KLSVVEVNSQ GIQFRADAEL  660
GVLSSLASDE KNQKIPLLKR DIIMNMEELP KRCDHQNLTR GFLRSRPTTF VLVSLVVCLA  720
VCVSVFHHGR VNELAVSIRR CLFNH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-32991691585squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150162RRKLERHNTRRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.83810.0leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1519140.0AC151914.19 Medicago truncatula clone mth2-29f16, complete sequence.
GenBankAC1643950.0AC164395.7 Medicago truncatula clone mth2-69h11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003594035.20.0squamosa promoter-binding-like protein
TrEMBLG7IFL10.0G7IFL1_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA13G28460.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64703450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]